PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G012800.1.p
Common NamePRUPE_ppa016923mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB
Protein Properties Length: 337aa    MW: 37764.5 Da    PI: 6.5085
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G012800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.12.6e-152976148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l ++    G g+W+ Iar  g+ R++k+c++rw +yl
  Prupe.2G012800.1.p 29 KGLWSPEEDEKLMRYMLTNGQGCWSDIARNAGLQRCGKSCRLRWINYL 76
                        678*******************************************97 PP

2Myb_DNA-binding50.64.3e-1682125146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+++++E+el+v+ +  lG++ W+ Ia++++ gRt++++k++w++
  Prupe.2G012800.1.p  82 RGAFSPQEEELIVHFHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 125
                         89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3362476IPR017930Myb domain
SuperFamilySSF466893.74E-2827123IPR009057Homeodomain-like
SMARTSM007172.1E-112878IPR001005SANT/Myb domain
PfamPF002496.2E-142976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-233083IPR009057Homeodomain-like
CDDcd001676.80E-103276No hitNo description
PROSITE profilePS5129424.9877131IPR017930Myb domain
SMARTSM007174.1E-1581129IPR001005SANT/Myb domain
PfamPF002491.4E-1482125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2584132IPR009057Homeodomain-like
CDDcd001677.64E-1184124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MRKPESMGKE EGANNINKKK KMILSKLRKG LWSPEEDEKL MRYMLTNGQG CWSDIARNAG  60
LQRCGKSCRL RWINYLRPDL KRGAFSPQEE ELIVHFHSIL GNRWSQIAAR LPGRTDNEIK  120
NFWNSALKKR LKKNNISTSL SSPNDSDSSE PRDVNITGGT TFMPMHDHDM MTMTMYNMDS  180
SSSSSASMQA MFVNSNTLFD PFSMLDHRYD MAHADATLNV NPTCLANLPN IGDQGYYGDC  240
GNLGAGHKMG LEGDLCVPAL ESRSVESNVN GQVAENISKT INNHFHNNCF NNTTEMIGFK  300
VDEDMLGFGN NGHGENLRMG EWDFEGFMQD ISSFLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-272013118128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9703571e-112AY970357.1 Prunus salicina clone PSX08 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008231282.10.0PREDICTED: transcription factor MYB86-like
TrEMBLM5XMW60.0M5XMW6_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s06630.11e-126(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.12e-67myb domain protein 46